Invitrogen™ Human BAG3 (aa 466-575) Control Fragment Recombinant Protein

Product Code. 30202853

Brand: Invitrogen™ RP92057

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53818 (PA5-53818. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BAG3 are among BAG proteins that compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.

Specifications

• Accession Number: O95817
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9531
• Name: Human BAG3 (aa 466-575) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA407278; BAG family molecular chaperone regulator 3; BAG3; BAG-3; BCL2 associated athanogene 3; Bcl-2-associated athanogene 3; Bcl2-associated athanogene 3; BCL2-binding athanogene 3; bcl-2-binding protein Bis; Bcl-2-interacting death suppressor; BIS; CAIR-1; DKFZp434E0610; docking protein CAIR-1; MFM6; mg638; MGC104307; MNCb-2243
• Common Name: BAG3
• Gene Symbol: BAG3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining