Invitrogen™ Human BAFF (aa 1-46) Control Fragment Recombinant Protein

Product Code. 30201651

Brand: Invitrogen™ RP108793

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BAFF is a membrane bound cytokine expressed by B cell lineage cells. The soluble form of the cytokine binds to the receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. BAFF is a potent B cell activator, and important for the proliferation and differentiation of B cells. BAFF is also expressed by T lymphocytes and has been shown to promote T cell activation and survival. Isoforms representing alternatively spliced, and glycosylated variants have been identified.

Specifications

• Accession Number: Q9Y275
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10673
• Name: Human BAFF (aa 1-46) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ApoL related ligand TALL-1; b cell-activating factor; B lymphocyte stimulator; BAFF; B-cell-activating factor; B-lymphocyte stimulator; BLYS; CD257; D8Ertd387e; delta BAFF; Delta4 BAFF; dendritic cell-derived TNF-like molecule; DTL; RGD1561519; TALL1; TALL-1; THANK; TNF- and APOL-related leukocyte expressed ligand 1; TNF and ApoL-related leukocyte expressed ligand 1; TNF homolog that activates apoptosis; Tnfsf13b; TNFSF20; TNLG7A; tumor necrosis factor (ligand) superfamily member 13 b; tumor necrosis factor (ligand) superfamily, member 13 b; tumor necrosis factor (ligand) superfamily, member 20; tumor necrosis factor ligand 7 A; tumor necrosis factor ligand superfamily member 13 B; Tumor necrosis factor ligand superfamily member 13 b, membrane form; Tumor necrosis factor ligand superfamily member 13 b, soluble form; tumor necrosis factor superfamily member 13 b; tumor necrosis factor-like protein ZTNF4; UNQ401/PRO738; ZTNF4
• Common Name: BAFF (BLyS)
• Gene Symbol: TNFSF13B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining