missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BAD (aa 103-161) Control Fragment Recombinant Protein

Código de producto. 30205571
Click to view available options
Quantity:
100 μL
Tamaño de la unidad:
100µL
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30205571

Marca: Invitrogen™ RP103433

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by BAD is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform.
TRUSTED_SUSTAINABILITY

Especificaciones

Accession Number Q92934
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 572
Name Human BAD (aa 103-161) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI325008; BAD; Bbc2; Bbc6; Bcl2 antagonist of cell death; BCL2 associated agonist of cell death; bcl-2 associated death agonist; Bcl2-antagonist of cell death; BCL2-antagonist of cell death protein; bcl2-associated agonist of cell death; bcl2-associated death promoter; bcl-2-binding component 6; BCL2-binding component 6; BCL2-binding protein; BCL2L8; bcl2-L-8; Bcl-2-like protein 8; BCL-X/BCL-2 binding protein; bcl-XL/Bcl-2-associated death promoter; hypothetical protein LOC615013; OTTMUSP00000017561; OTTMUSP00000022400
Common Name BAD
Gene Symbol BAD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado