Invitrogen™ Human BAAT1 (aa 287-372) Control Fragment Recombinant Protein

Código de producto. 30205699

Marca: Invitrogen™ RP108088

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67427 (PA5-67427. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for activation of ATM following ionizing radiation. May act by regulating dephosphorylation of ATM.

Especificaciones

• Accession Number: Q6PJG6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 221927
• Name: Human BAAT1 (aa 287-372) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA881470; BAAT1; Brat1; Brat1-ps1; BRCA1 associated ATM activator 1; BRCA1-associated ATM activator 1; BRCA1-associated ATM activator 1, pseudogene 1; BRCA1-associated protein required for ATM activation protein 1; C7orf27; HEAT repeat-containing protein C7orf27; MGC22916; RGD1565146; RMFSL
• Common Name: BAAT1
• Gene Symbol: BRAT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSSCAGLLCRTLAHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining