Invitrogen™ Human B4GALNT1 (aa 192-325) Control Fragment Recombinant Protein

Product Code. 30206897

Brand: Invitrogen™ RP90252

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53282 (PA5-53282. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. Three transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q00973
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2583
• Name: Human B4GALNT1 (aa 192-325) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: (N-acetylneuraminyl)-galactosylglucosylceramide; 4933429D13Rik; B4galnt1; Beta-1,4 N-acetylgalactosaminyltransferase 1; beta1,4 GalNAC-T; beta-1,4-N-acetyl-galactosaminyl transferase 1; beta-1,4-N-acetyl-galactosaminyltransferase 1; beta-4 N-acetylgalactosaminyltransferase; GALGT; Galgt1; GalNAcT; Gal-NAc-T; GalNAc-T; GD2 synthase, GM2 synthase; Ggm2; Ggm-2; GM2/GD2 synthase; SIAT2; SPG26; UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1; UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase (GalNAc-T); UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramide-beta-1, 4-N-acetylgalactosaminyltransferase
• Common Name: B4GALNT1
• Gene Symbol: B4GALNT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining