Invitrogen™ Human B3GNT3 (aa 94-235) Control Fragment Recombinant Protein

Product Code. 30204927

Brand: Invitrogen™ RP88799

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55045 (PA5-55045. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the beta-1, 3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking.

Specifications

• Accession Number: Q9Y2A9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10331
• Name: Human B3GNT3 (aa 94-235) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210008L19Rik; B3GALT8; B3GAL-T8; B3gnt3; B3GN-T3; B3GNT-3; Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase; Beta-1,3-galactosyltransferase 8; Beta-1,3-GalTase 8; beta-1,3-Gn-T3; beta-1,3-N-acetylglucosaminyltransferase 3; beta-1,3-N-acetylglucosaminyltransferase bGnT-3; beta3GalT8; beta3Gn-T3; beta-3-Gx-T8; BGnT-3; core 1 beta-1,3-N-acetylglucosaminyltransferase; core 1 extending beta-1,3-N-acetylglucosaminyltransferase; Core1-beta3GlcNAcT; HP10328; N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3; putative type II membrane protein; TMEM3; Transmembrane protein 3; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3; UNQ637/PRO1266
• Common Name: B3GNT3
• Gene Symbol: B3gnt3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining