Invitrogen™ Human B-Raf (aa 299-447) Control Fragment Recombinant Protein

Product Code. 30196064

Brand: Invitrogen™ RP96774

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81931 (PA5-81931. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BRAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus. It is activated by somatic point mutation in human cancer, and is thought to play a role in the postsynaptic responses of hippocampal neuron. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in B-Raf have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for B-Raf.

Specifications

• Accession Number: P15056
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 673
• Name: Human B-Raf (aa 299-447) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 94 kDa B-raf protein; 9930012E13Rik; AA120551; AA387315; AA473386; Braf; B-raf; B-raf protein; B-raf protein isoform 1; B-raf protein isoform 2; B-Raf proto-oncogene serine/threonine-protein kinase; B-Raf proto-oncogene serine/threonine-protein kinase (p94); B-Raf proto-oncogene, serine/threonine kinase; Braf transforming gene; BRAF1; B-RAF1; Braf2; Braf-2; C230098H17; C87398; C-RMIL; D6Ertd631e; FLJ95109; MGC126806; murine sarcoma viral (v-raf) oncogene homolog B1; NS7; p94; Proto-oncogene B-Raf; proto-oncogene c-Rmil; RAFB1; RMIL; rmil serine/threonine-protein kinase; serine/threonine kinase; serine/threonine-protein kinase B-raf; Serine/threonine-protein kinase Rmil; v-raf murine sarcoma viral oncogene homolog B; v-raf murine sarcoma viral oncogene homolog B1
• Common Name: B-Raf
• Gene Symbol: BRAF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining