Invitrogen™ Human AZIN1 (aa 124-209) Control Fragment Recombinant Protein

Product Code. 30213086

Brand: Invitrogen™ RP93830

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82991 (PA5-82991. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Antizyme inhibitor (AZIN1) protein that positively regulates ornithine decarboxylase (ODC) activity and polyamine uptake. AZI is an enzymatically inactive ODC homolog that counteracts the negative effect of ODC antizymes (AZs) OAZ1, OAZ2 and OAZ3 on ODC activity by competing with ODC for antizyme-binding. Inhibits antizyme-dependent ODC degradation and releases ODC monomers from their inactive complex with antizymes, leading to formation of the catalytically active ODC homodimer and restoring polyamine production.

Specifications

• Accession Number: O14977
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51582
• Name: Human AZIN1 (aa 124-209) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700085L02Rik; antizyme inhibitor 1; AZI; AZIA1; AZIN1; O OAZIN; OAZI; Oazin; ODC antizyme inhibitor; ODC1L; Ornithine decarboxylase antizyme inhibitor
• Common Name: AZIN1
• Gene Symbol: AZIN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining