Invitrogen™ Human AWAT1 (aa 68-118) Control Fragment Recombinant Protein

Product Code. 30201632

Brand: Invitrogen™ RP103862

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64118 (PA5-64118. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin. [provided by RefSeq, Sep 2009].

Specifications

• Accession Number: Q58HT5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 158833
• Name: Human AWAT1 (aa 68-118) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Acyl-CoA wax alcohol acyltransferase 1; AWAT1; DGA2; Dgat2l3; diacylglycerol acyltransferase 2; diacyl-glycerol acyltransferase 2; diacylglycerol O-acyltransferase 2-like 3; diacylglycerol O-acyltransferase 2-like protein 3; Long-chain-alcohol O-fatty-acyltransferase 1; wax synthase 1
• Common Name: AWAT1
• Gene Symbol: AWAT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining