Invitrogen™ Human Aurora C (aa 6-43) Control Fragment Recombinant Protein

Product Code. 30194060

Brand: Invitrogen™ RP97243

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AURKC (Aurora C) is a chromosomal passenger protein that forms complexes with AURKB (Aurora B) and inner centromere proteins, playing a role in organizing microtubules in relation to centrosome/spindle function during mitosis. It is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Studies on the temporal expression pattern and subcellular localization of Aurora kinases in mitotic cells suggest an association with mitotic structure. Aurora kinase functional influences span from G2 phase to cytokinesis and may be involved in key cell cycle events such as centrosome duplication, chromosome bi-orientation and segregation, cleavage furrow positioning, and ingression.

Specifications

• Accession Number: Q9UQB9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6795
• Name: Human Aurora C (aa 6-43) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AIE1; AIE2; AIK3; AIRK3; ARK3; ARK-3; AurC; AURKC; Aurora 3; aurora B; aurora kinase C; aurora/Ipl1/Eg2 protein 1; aurora/IPL1/EG2 protein 2; aurora/IPL1-related kinase 3; aurora-C; aurora-related kinase 3; epididymis secretory protein Li 90; HEL-S-90; IAK3; serine/threonine kinase 13 (aurora/IPL1-like); serine/threonine kinase 13 (aurora/IPL-like); serine/threonine-protein kinase 13; Serine/threonine-protein kinase aurora-C; SPGF5; STK13
• Common Name: Aurora C
• Gene Symbol: AURKC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining