Invitrogen™ Human Aurora B (aa 10-75) Control Fragment Recombinant Protein

Product Code. 30213085

Brand: Invitrogen™ RP105937

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Aurora kinases associate with microtubules during chromosome movement and segregation. AURKB (Aurora B) localizes to microtubules near kinetochores, specifically to the specialized microtubules called K-fibers. This complex functions in chromosome alignment and separation, histone modification, and cytokinesis. CPC also includes three non-enzymatic subunits known as the inner centromere protein (INCENP), survivin, and borealin, which determine the activity, localization, stability, and possibly even the substrate specificity of AurB. Two CPCs exist during mitosis: one containing all four members and another consisting of INCENP and AurB. Quaternary CPC functions during chromosome alignment and cytokinesis, whereas the INCENP-AurB complex may be responsible for modifying histone H3. AurB is overexpressed in a number of tumours, including primary breast and colon tumour samples. Its expression in tumours seems to be linked with Aurora-A kinase, suggesting a feedback mechanism between the two proteins.

Specifications

• Accession Number: Q96GD4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9212
• Name: Human Aurora B (aa 10-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Aik2; AIM1; AIM-1; AIRK2; AL022959; ARK2; ARK-2; AurB; AURKB; aurkb-sv1; aurkb-sv2; aurora 1; aurora- and IPL1-like midbody-associated protein 1; aurora B; aurora kinase B; aurora kinase B-Sv1; aurora kinase B-Sv2; aurora/IPL1-related kinase 2; aurora-1; aurora-B; aurora-related kinase 2; IPL1; PPP1R48; protein phosphatase 1, regulatory subunit 48; serine/threonine kinase; serine/threonine kinase 12; serine/threonine kinase 5; Serine/threonine-protein kinase 12; Serine/threonine-protein kinase 5; serine/threonine-protein kinase aurora-B; STK1; STK-1; Stk12; STK12; AIK2; AIM1; ARK2; IPL1; AIM-1; STK5
• Common Name: Aurora B
• Gene Symbol: AURKB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining