Invitrogen™ Human AURKAIP1 (aa 137-197) Control Fragment Recombinant Protein

Product Code. 30211471

Brand: Invitrogen™ RP94467

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56869 (PA5-56869. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AURKA is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. The encoded protein is found at the centrosome in interphase cells and at the spindle poles in mitosis. This gene may play a role in tumor development and progression.

Specifications

• Accession Number: Q9NWT8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54998
• Name: Human AURKAIP1 (aa 137-197) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610033H09Rik; 28 S ribosomal protein S38, mitochondrial; Aip; AKIP; AURKA; AURKA-interacting protein; AURKAIP1; aurora kinase A interacting protein 1; aurora kinase A-interacting protein; aurora-A kinase interacting protein; Mitochondrial small ribosomal subunit protein mS38; Mrps38; MRP-S38
• Common Name: AURKAIP1
• Gene Symbol: AURKAIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining