Invitrogen™ Human AUH (aa 27-123) Control Fragment Recombinant Protein

Product Code. 30196866

Brand: Invitrogen™ RP102313

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52067 (PA5-52067. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The methylglutaconyl-CoA hydratase, mitochondrial protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40- kDa precursor protein which is subsequently processed to a 32- kDa mature form.

Specifications

• Accession Number: Q13825
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 549
• Name: Human AUH (aa 27-123) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3-methylglutaconyl-CoA hydratase; AU RNA binding methylglutaconyl-CoA hydratase; AU RNA binding protein/enoyl-CoA hydratase; AU RNA binding protein/enoyl-coenzyme A hydratase; AU RNA-binding protein/enoyl-Coenzyme A hydratase; AU-binding enoyl-CoA hydratase; AU-binding protein/enoyl-CoA hydratase; Auh; AU-specific RNA-binding enoyl-CoA hydratase; C77140; Itaconyl-CoA hydratase; Methylglutaconyl-CoA hydratase, mitochondrial; muAUH; W91705
• Common Name: AUH
• Gene Symbol: AUH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining