Invitrogen™ Human ATXN7L2 (aa 262-340) Control Fragment Recombinant Protein

Product Code. 30198861

Brand: Invitrogen™ RP94399

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56270 (PA5-56270. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCA7 is an autosomal dominant neurodegenerative disorder characterized by ataxia and selective neuronal cell loss caused by the expansion of a translated CAG repeat encoding a polyglutamine tract in ataxin-7, which is the SCA7 gene product. Ataxin-7 is a nuclear protein that is expressed within neurons both affected and unaffected in SCA7 pathology with subcellular localization being variable depending upon the neuronal subtype. Polyglutamine expanded in ataxin-7 may carry out its pathogenic effects in the nucleus by altering the matrix-associated nuclear structure and/or by disrupting nucleolar function.ATXN7L2 (Ataxin-7-like protein 2) is a 722 amino acid protein that contains a SCA7 domain, which is highly conserved through all members of the ATXN7 gene family. The gene encoding ATXN7L2 maps to human chromosome 1, the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome.

Specifications

• Accession Number: Q5T6C5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 127002
• Name: Human ATXN7L2 (aa 262-340) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610528J18Rik; ataxin 7 like 2; ataxin 7-like 1; ataxin 7-like 2; ataxin-7-like protein 2; ATXN7L2; mFLJ00381 protein; RGD1307047
• Common Name: ATXN7L2
• Gene Symbol: ATXN7L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IHSVHQRREVQGRAKDFDVLVAELKANSRKGESPKEKSPGRKEQVLERPSQELPSSVQVVAAVAAPSSTFSVRAKQTYP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining