Invitrogen™ Human ATXN1L (aa 195-261) Control Fragment Recombinant Protein

Product Code. 30195255

Brand: Invitrogen™ RP107176

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66506 (PA5-66506. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Chromatin-binding factor that repress Notch signaling in the absence of Notch intracellular domain by acting as a CBF1 corepressor. Binds to the HEY promoter and might assist, along with NCOR2, RBPJ-mediated repression (PubMed:21475249). Can suppress ATXN1 cytotoxicity in spinocerebellar ataxia type 1 (SCA1). In concert with CIC and ATXN1, involved in brain development. [UniProt]

Specifications

• Accession Number: P0C7T5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 342371
• Name: Human ATXN1L (aa 195-261) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ankyrin repeat and SOCS box containing 16; ankyrin repeat and SOCS box protein 16; ankyrin repeat and SOCS box-containing 16; ankyrin repeat and SOCS box-containing protein 16; ASB16; ASB-16; ataxin 1 like; ataxin 1-like; ataxin-1-like; ATXN1L; BOAT; BOAT1; Brother of ataxin-1; brother of ATXN1
• Common Name: ATXN1L
• Gene Symbol: ATXN1L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AHSFNKAPSATSPSGQLPHHSSTQPLDLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQESQS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining