Invitrogen™ Human ATXN10 (aa 209-279) Control Fragment Recombinant Protein

Product Code. 30201481

Brand: Invitrogen™ RP101275

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61999 (PA5-61999. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The autosomal dominant cerebellar ataxias (ADCAs) are a clinically and genetically heterogeneous group of disorders characterized by ataxia, dysarthria, dysmetria, and intention tremor. All ADCAs involve some degree of cerebellar dysfunction and a varying degree of signs from other components of the nervous system. A commonly accepted clinical classification (Harding, 1993) divides ADCAs into 3 different groups based on the presence or absence of associated symptoms such as brainstem signs or retinopathy. The presence of pyramidal and extrapyramidal symptoms and ophthalmoplegia makes the diagnosis of ADCA I, the presence of retinopathy points to ADCA II, and the absence of associated signs to ADCA III. Genetic linkage and molecular analyses revealed that ADCAs are genetically heterogeneous even within the various subtypes.

Specifications

• Accession Number: Q9UBB4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25814
• Name: Human ATXN10 (aa 209-279) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI325283; ataxin 10; ataxin 10 homolog; ataxin-10; ATXN10; Brain protein E46; brain protein E46 homolog; C77170; E46; E46L; HUMEEP; Neuronal beta-catenin-like protein; Sca10; spinocerebellar ataxia 10; spinocerebellar ataxia 10 homolog; spinocerebellar ataxia type 10 protein; Spinocerebellar ataxia type 10 protein homolog; TEG-169; testis expressed gene 169; Te x 169
• Common Name: ATXN10
• Gene Symbol: ATXN10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAELIASTF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining