Invitrogen™ Human ATRX (aa 2273-2413) Control Fragment Recombinant Protein

Product Code. 30205085

Brand: Invitrogen™ RP92134

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51656 (PA5-51656. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATRX encodes a protein that contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Specifications

• Accession Number: P46100
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 546
• Name: Human ATRX (aa 2273-2413) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4833408C14Rik; AI447451; alpha thalassemia/mental retardation syndrome (X-linked); alpha thalassemia/mental retardation syndrome X-linked; alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae); alpha thalassemia/mental retardation syndrome X-linked homolog; alpha thalassemia/mental retardation syndrome X-linked homolog (human); ATP-dependent helicase ATRX; ATR2; ATRX; ATRX, chromatin remodeler; DNA dependent ATPase and helicase; DXHXS6677E; helicase 2; helicase 2, X-linked; helicase II; heterochromatin protein 2; HP1 alpha-interacting protein; Hp1bp2; Hp1bp38; HP1-BP38; HP1-BP38 protein; JMS; mental retardation, X-linked 52; MRX52; MRXHF1; MRXS3; pABP-2; Rad54; RAD54L; RP5-875J14.1; SFM1; SHS; transcriptional regulator ATRX; XH2; X-linked helicase II; X-linked nuclear protein; XNP; Zinc finger helicase; Znf-HX
• Common Name: ATRX
• Gene Symbol: ATRX
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining