Invitrogen™ Human ATPAF1 (aa 250-326) Control Fragment Recombinant Protein

Product Code. 30197539

Brand: Invitrogen™ RP94167

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60870 (PA5-60870. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Specifications

• Accession Number: Q5TC12
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64756
• Name: Human ATPAF1 (aa 250-326) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330547J17Rik; AI593252; ATP synthase mitochondrial F1 complex assembly factor 1; ATP11; ATP11 homolog; ATP11p; ATPAF1; homolog of yeast ATP11
• Common Name: ATPAF1
• Gene Symbol: ATPAF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining