missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP8A1 (aa 1090-1151) Control Fragment Recombinant Protein

Product Code. 30198367
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198367

Brand: Invitrogen™ RP100935

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62707 (PA5-62707. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The P-type adenosinetriphosphatases (P-type ATPases) are a family of proteins which use the free energy of ATP hydrolysis to drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily catalyzes transport of heavy metal ions. Another subfamily transports non-heavy metal ions (NMHI). The protein encoded by this gene is a member of the third subfamily of P-type ATPases and acts to transport amphipaths, such as phosphatidylserine. Two transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y2Q0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10396
Name Human ATP8A1 (aa 1090-1151) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI481521; AI853962; aminophospholipid translocase; APLT; Atp3a2; Atp8a1; ATPase 8A1, aminophospholipid transporter (APLT), class I; ATPase 8A1, p type; ATPase class I type 8 A member 1; ATPase II; ATPase phospholipid transporting 8A1; ATPase, aminophospholipid transporter (APLT), class I, type 8 A, member 1; ATPASEII; Atpc1; ATPIA; ATPP2; AW743152; AW822227; B230107D19Rik; Chromaffin granule ATPase II; ClassI; P4-ATPase flippase complex alpha subunit ATP8A1; phospholipid-transporting ATPase IA; probable phospholipid-transporting ATPase IA
Common Name ATP8A1
Gene Symbol ATP8A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSQDPGAVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.