Invitrogen™ Human ATP8A1 (aa 1090-1151) Control Fragment Recombinant Protein

Product Code. 30198367

Brand: Invitrogen™ RP100935

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62707 (PA5-62707. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The P-type adenosinetriphosphatases (P-type ATPases) are a family of proteins which use the free energy of ATP hydrolysis to drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily catalyzes transport of heavy metal ions. Another subfamily transports non-heavy metal ions (NMHI). The protein encoded by this gene is a member of the third subfamily of P-type ATPases and acts to transport amphipaths, such as phosphatidylserine. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9Y2Q0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10396
• Name: Human ATP8A1 (aa 1090-1151) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI481521; AI853962; aminophospholipid translocase; APLT; Atp3a2; Atp8a1; ATPase 8A1, aminophospholipid transporter (APLT), class I; ATPase 8A1, p type; ATPase class I type 8 A member 1; ATPase II; ATPase phospholipid transporting 8A1; ATPase, aminophospholipid transporter (APLT), class I, type 8 A, member 1; ATPASEII; Atpc1; ATPIA; ATPP2; AW743152; AW822227; B230107D19Rik; Chromaffin granule ATPase II; ClassI; P4-ATPase flippase complex alpha subunit ATP8A1; phospholipid-transporting ATPase IA; probable phospholipid-transporting ATPase IA
• Common Name: ATP8A1
• Gene Symbol: ATP8A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSQDPGAVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining