missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP6V1C2 (aa 111-173) Control Fragment Recombinant Protein

Product Code. 30208926
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208926 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208926 Supplier Invitrogen™ Supplier No. RP108526

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84754 (PA5-84754. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V1C2 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NEY4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 245973
Name Human ATP6V1C2 (aa 111-173) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110038G14Rik; Atp6c2; Atp6v1c2; ATPase H+ transporting V1 subunit C2; ATPase, H+ transporting, lysosomal 42 kDa, V1 subunit C2; ATPase, H+ transporting, lysosomal V1 subunit C2; ATPase, H+ transporting, V1 subunit C, isoform 2; vacuolar H+ ATPase C2; vacuolar proton pump subunit C 2; V-ATPase C2 subunit; V-ATPase subunit C 2; VMA5; V-type ATPase C2 subunit a isoform; V-type proton ATPase subunit C 2
Common Name ATP6V1C2
Gene Symbol Atp6v1c2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.