Invitrogen™ Human ATP6V1C2 (aa 111-173) Control Fragment Recombinant Protein

Product Code. 30208926

Brand: Invitrogen™ RP108526

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84754 (PA5-84754. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V1C2 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms.

Specifications

• Accession Number: Q8NEY4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 245973
• Name: Human ATP6V1C2 (aa 111-173) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110038G14Rik; Atp6c2; Atp6v1c2; ATPase H+ transporting V1 subunit C2; ATPase, H+ transporting, lysosomal 42 kDa, V1 subunit C2; ATPase, H+ transporting, lysosomal V1 subunit C2; ATPase, H+ transporting, V1 subunit C, isoform 2; vacuolar H+ ATPase C2; vacuolar proton pump subunit C 2; V-ATPase C2 subunit; V-ATPase subunit C 2; VMA5; V-type ATPase C2 subunit a isoform; V-type proton ATPase subunit C 2
• Common Name: ATP6V1C2
• Gene Symbol: Atp6v1c2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining