Invitrogen™ Human ATP6V1B1 (aa 1-66) Control Fragment Recombinant Protein

Product Code. 30213206

Brand: Invitrogen™ RP96039

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56878 (PA5-56878. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vacuolar-type H+-ATPase (V-ATPase) is a multisubunit enzyme responsible for acidification of eukaryotic intracellular organelles. V-ATPases pump protons against an electrochemical gradient, while F-ATPases reverse the process, thereby synthesizing ATP. A peripheral V1 domain, which is responsible for ATP hydrolysis, and a integral V0 domain, which is responsible for proton translocation, compose V-ATPase. Nine subunits (A-H) make up the V1 domain and five subunits (a, d, c, c' and c') make up the V0 domain. Like F-ATPase, V-ATPase most likely operates through a rotary mechanism. The V-ATPase V1 B subunit exists as two isoforms. In the inner ear, the V-ATPase B1 isoform functions in proton secretion and is required to maintain proper endolymph pH and normal auditory function. The gene encoding the human V-ATPase B1 isoform maps to chromosome 2cen-q13. Mutations in this gene cause distal renal tubular acidosis associated with sensorineural deafness. The V-ATPase B2 isoform is expressed in kidney and is the only B isoform expressed in osteoclasts.

Specifications

• Accession Number: P15313
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 525
• Name: Human ATP6V1B1 (aa 1-66) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATP6B1; ATP6V1B1; ATPase H+ transporting V1 subunit B1; ATPase, H transporting, lysosomal V1 subunit B1; ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta 56/58 kDa, isoform 1; ATPase, H+ transporting, lysosomal 56/58 kDa, V1 subunit B, isoform 1; ATPase, H+ transporting, lysosomal 56/58 kDa, V1 subunit B1; ATPase, H+ transporting, lysosomal 56/58 kDa, V1 subunit B1 (Renal tubular acidosis with deafness); ATPase, H+ transporting, lysosomal V1 subunit B1; ATPase, H+ transporting, V1 subunit B, isoform 1; AW208839; D630003L15; D630030L16Rik; D630039P21Rik; endomembrane proton pump 58 kDa subunit; H(+)-transporting two-sector ATPase, 58 kD subunit; H+-ATPase beta 1 subunit; lysosomal 56/58 kDa; RTA1B; vacuolar H+-ATPase; vacuolar proton pump 3; vacuolar proton pump subunit B 1; vacuolar proton pump, subunit 3; VATB; V-ATPase B1; V-ATPase B1 subunit; V-ATPase subunit B 1; VMA2; VPP3; Vpp-3; V-type proton ATPase subunit B, kidney isoform
• Common Name: V-ATPase B1
• Gene Symbol: Atp6v1b1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining