Invitrogen™ Human ATP6V0D2 (aa 235-285) Control Fragment Recombinant Protein

Product Code. 30210891

Brand: Invitrogen™ RP101339

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63109 (PA5-63109. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.

Specifications

• Accession Number: Q8N8Y2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 245972
• Name: Human ATP6V0D2 (aa 235-285) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1620401A02Rik; AI324824; ATP6D2; Atp6v0d2; ATPase H+ transporting V0 subunit d2; ATPase, H+ transporting, lysosomal 38 kDa, V0 subunit d2; ATPase, H+ transporting, lysosomal V0 subunit D2; ATPase, H+ transporting, V0 subunit D, isoform 2; FLJ38708; osteoclast-specific vacuolar ATP synthase; similar to ATPase, H+ transporting, V0 subunit D isoform 2; vacuolar proton pump subunit d 2; vacuolar proton-translocating ATPase d subunit d2; V-ATPase; V-ATPase subunit d 2; VMA6; V-type proton ATPase subunit d 2
• Common Name: ATP6V0D2
• Gene Symbol: ATP6V0D2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining