Invitrogen™ Human ATP6V0D1 (aa 230-321) Control Fragment Recombinant Protein

Product Code. 30198261

Brand: Invitrogen™ RP89908

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53520 (PA5-53520. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously.

Specifications

• Accession Number: P61421
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9114
• Name: Human ATP6V0D1 (aa 230-321) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 32 kd accessory protein; 32 kDa accessory protein; Ac39; AI267038; Atp6d; ATP6DV; Atp6v0d1; ATPase H+ transporting V0 subunit d1; ATPase, H+ transporting, lysosomal (vacuolar proton pump), 42 kDa; ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D; ATPase, H+ transporting, lysosomal 38 kDa, V0 subunit D; ATPase, H+ transporting, lysosomal 38 kDa, V0 subunit d1; ATPase, H+ transporting, lysosomal V0 subunit D1; ATPase, H+ transporting, lysosomal, V0 subunit d1; ATPase, H+ transporting, V0 subunit D; cto; fb73h07; FLJ43534; H(+)-transporting two-sector ATPase, subunit D; lysosomal 38 kDa; P39; Physophilin; Unknown (protein for MGC:63769); Vacuolar proton pump subunit d 1; vacuolar proton-ATPase, subunit D; V-ATPase, subunit D; V-ATPase 40 KDa accessory protein; V-ATPase AC39 subunit; V-ATPase subunit d 1; V-ATPase, subunit D; VATX; Vma6; VPATPD; V-type proton ATPa; V-type proton ATPase subunit d 1; wu:fb73h07; zgc:63769
• Common Name: ATP6V0D1
• Gene Symbol: ATP6V0D1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining