Invitrogen™ Human ATP6IP2 (aa 171-308) Control Fragment Recombinant Protein

Product Code. 30201841

Brand: Invitrogen™ RP92251

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.

Specifications

• Accession Number: O75787
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10159
• Name: Human ATP6IP2 (aa 171-308) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: (P)RR; (pro)renin receptor; 5730403E06Rik; APT6M8-9; ATP6AP2; Atp6ip2; ATP6M8-9; ATPase H(+)-transporting lysosomal accessory protein 2; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase H+ transporting accessory protein 2; ATPase, H(+)-transporting, lysosomal-interacting protein 2; ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9; ATPase, H+ transporting, lysosomal accessory protein 2; ATPase, H+ transporting, lysosomal interacting protein 1; ATPase, H+ transporting, lysosomal interacting protein 2; CAPER; ELDF10; embryonic liver differentiation factor 10; ER-localized type I transmembrane adaptor; HT028; M8-9; MGC99577; MRXE; MRXSH; MSTP009; N14F; prorenin receptor; PRR; PSEC0072; Renin receptor; Renin receptor C-terminal fragment; Renin receptor cytoplasmic fragment; Renin receptor extracellular fragment; Renin receptor N-terminal fragment; Renin/prorenin receptor; RENR; vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8-9; V-ATPase M8.9 subunit; XMRE; XPDS
• Common Name: ATP6IP2
• Gene Symbol: Atp6ap2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining