Invitrogen™ Human ATP6AP1L (aa 74-148) Control Fragment Recombinant Protein

Product Code. 30195687

Brand: Invitrogen™ RP96985

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62837 (PA5-62837. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6AP1L gene ontology annotations related to this gene include ATP hydrolysis coupled proton transport.

Specifications

• Accession Number: Q52LC2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92270
• Name: Human ATP6AP1L (aa 74-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATP6AP1L; ATPase H+ transporting accessory protein 1 like; ATPase, H+ transporting, lysosomal accessory protein 1-like; Vacuolar proton pump subunit S1-like protein; V-type proton ATPase subunit S1-like protein
• Common Name: ATP6AP1L
• Gene Symbol: ATP6AP1L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQIQGFAIKGGRFTKAQDCASSFSPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining