missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP5S (aa 75-141) Control Fragment Recombinant Protein

Product Code. 30210650
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210650

Brand: Invitrogen™ RP107184

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66517 (PA5-66517. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP5S, also known as ATP synthase subunits, mitochondrial, ATP synthase-coupling factor B or ATP synthase, H+ transporting, mitochondrial F0 complex, subunits (factor B), is a 215 amino acid mitochondrial inner membrane protein that belongs to the ATP synthase subunits family. Involved in regulation of mitochondrial membrane ATP synthase, ATP5S is necessary for H+ conduction of ATP synthase. The ATP5S gene encodes subunits, also known as factor B, of the proton channel. This subunit is necessary for energy transduction in ATP synthase complexes. The ATP5S gene is conserved in chimpanzee, canine, bovine, mouse, rat, chicken, zebrafish and mosquito, and maps to human chromosome 14q21.3.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99766
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27109
Name Human ATP5S (aa 75-141) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110015E18Rik; ATP synthase coupling factor B, mitochondrial; ATP synthase coupling factor B-like 1; ATP synthase subunit s, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit S; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit s (factor B); ATP synthase, H+ transporting, mitochondrial Fo complex subunit s (factor B); ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B); ATP synthase-coupling factor B; ATP5S; Atpw; Distal membrane arm assembly complex 2-like protein; DMAC2L; Factor B; facyor B; FB; HSU79253; Mitochondrial ATP synthase regulatory component factor B
Common Name ATP5S
Gene Symbol DMAC2L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.