Invitrogen™ Human ATP2C2 (aa 491-547) Control Fragment Recombinant Protein

Product Code. 30206059

Brand: Invitrogen™ RP108060

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67396 (PA5-67396. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP2C2, also known as secretory pathway Ca2+/Mn2+-ATPase (SPCA) 2, belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium from the cytosol to the Golgi lumen. Defects in the related gene ATP2C1 cause Hailey-Hailey disease, for which ATP2C2 does not compensate, suggesting that ATP2C2 plays other physiological roles. Unlike ATP2C1, ATP2C2 has a much more restricted expression pattern and displays a higher maximal turnover rate for overall Ca2+-ATPase reaction and a lower apparent affinity for cytosolic Ca2+ activation of phosphorylation. Overexpression of ATP2C2 in mammary tumors result a Ca2+ influx via the store-operated Ca2+ channel ORAI1 and independent of the STIM1 and STIM2 sensors.

Specifications

• Accession Number: O75185
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9914
• Name: Human ATP2C2 (aa 491-547) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810010G06Rik; Atp2c2; ATPase 2C2; ATPase secretory pathway Ca2+ transporting 2; ATPase, Ca++ transporting, type 2 C, member 2; calcium-transporting ATPase type 2 C member 2; Kiaa0703; mKIAA0703; Secretory pathway Ca(2+)-ATPase 2; secretory pathway Ca2+-ATPase; secretory pathway calcium ATPase 2; Spca2
• Common Name: ATP2C2
• Gene Symbol: ATP2C2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining