missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205841

Invitrogen™ Human ATP1B2 (aa 65-167) Control Fragment Recombinant Protein

Product Code. 30205841
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205841

Brand: Invitrogen™ RP90193

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52729 (PA5-52729. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-2 subunit is not known. Mediates cell adhesion of neurons and astrocytes, and promotes neurite outgrowth.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P14415
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 482
Name Human ATP1B2 (aa 65-167) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias adhesion molecule in glia; adhesion molecule on glia; AMOG; ATP1B2; ATPase Na+/K+ transporting subunit beta 2; ATPase, Na+/K+ transporting, beta 2 polypeptide; ATPase, Na+K+ transporting, beta polypeptide 2; ATPB2; Atpb-2; ATPB2S; glial cell adhesion molecule; Na, K-ATPase beta-2 polypeptide; Na,K-ATPase beta 2 subunit; Na+K+ ATPase beta 2 subunit; RATATPB2S; snoRNA MBI-85; Sodium Potassium ATPase; sodium pump subunit beta-2; sodium/potassium-dependent ATPase beta-2 subunit; sodium/potassium-dependent ATPase subunit beta-2; sodium/potassium-transporting ATPase beta-2 chain; sodium/potassium-transporting ATPase subunit beta-2; sodium-potassium ATPase subunit beta 2 (non-catalytic)
Common Name ATP1B2
Gene Symbol ATP1B2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.