Invitrogen™ Human ATP1A3 (aa 28-60) Control Fragment Recombinant Protein

Product Code. 30197743

Brand: Invitrogen™ RP103256

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84291 (PA5-84291. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The sodium/potassium ATPase is an integral membrane enzyme found in all cells of higher organisms and is responsible for the ATP-dependent transport of sodium and potassium across the cell membrane. This membrane-bound enzyme is related to a number of other ATPases including sarcoplasmic and endoplasmic reticulum calcium ATPase (SERCA) and plasma membrane calcium ATPase (PMCA). The sodium/potassium ATPase consists of a large, multipass, transmembrane catalytic subunit, termed the alpha subunit, and an associated smaller glycoprotein, termed the beta subunit. Studies indicate that there are three isoforms of the alpha subunit (alpha 1, alpha 2, alpha 3) and two isoforms of the beta subunit (beta 1 and beta 2) encoded by two multigene families. The different isoforms of the sodium/potassium ATPase exhibit tissue-specific and developmental patterns of expression. The alpha 1 and beta mRNAs are present in all cell types examined, whereas the alpha 2 and alpha 3 mRNAs exhibit a more restricted pattern of cell-specific expression. The alpha-3 subunit has been found in neuronal and to skeletal and cardiac muscle, lung and stomach tissues.

Specifications

• Accession Number: P13637
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 478
• Name: Human ATP1A3 (aa 28-60) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AHC2; ATP1A1; Atp1a3; ATPa1a3; Atpa-2; ATPase Na+/K+ transporting subunit alpha 3; ATPase, Na+/K+ transporting, alpha 3 polypeptide; ATPase, Na+K+ transporting, alpha 3 subunit; CAPOS; DYT12; EC 3.6.3.9; Na(+)/K(+) ATPase alpha(III) subunit; Na(+)/K(+) ATPase alpha-3 subunit; Na+, K+ activated adenosine triphosphatase alpha subunit; Na+/K+ ATPase 3; Na+/K+ -ATPase alpha 3 subunit; RDP; Sodium Potassium ATPase; Sodium pump 3; sodium pump subunit alpha-3; sodium/potassium-transporting ATPase alpha-3 chain; sodium/potassium-transporting ATPase subunit alpha-3; sodium-potassium ATPase catalytic subunit alpha-3; sodium-potassium-ATPase, alpha 3 polypeptide
• Common Name: ATP1A3
• Gene Symbol: ATP1A3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining