missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206032

Invitrogen™ Human ATP11B (aa 427-524) Control Fragment Recombinant Protein

Product Code. 30206032
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206032

Brand: Invitrogen™ RP96268

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57578 (PA5-57578. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP11B is a widely expressed integral membrane ATPase and is thought to drive the transport of phospholipids across membranes. It has been suggested that ATP11B is hormonally regulated and plays a role in the subnuclear trafficking of transcription factors with RING motifs. While the exact molecule ATP11B transports is unknown, increased mRNA expression of the homologous ATP11A has been observed in cells resistant to anti-cancer drugs such as farnesyltransferase inhibitors (FTIs), suggesting that ATP11B may also play a role in cell survival under harsh conditions.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y2G3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23200
Name Human ATP11B (aa 427-524) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110019I14Rik; ATP11B; ATPase class VI type 11 B; ATPase IR; ATPase phospholipid transporting 11 B (putative); ATPase, class VI, type 11 B; ATPIF; ATPIR; KIAA0956; mKIAA0956; P4-ATPase flippase complex alpha subunit ATP11B; Probable phospholipid-transporting ATPase IF; TIEG; TIEG1; truncated ATPase 11 B protein
Common Name ATP11B
Gene Symbol ATP11B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MKYQEINGRLVPEGPTPDSSEGNLSYLSSLSHLNNLSHLTTSSSFRTSPENETELIKEHDLFFKAVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.