missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP11A (aa 697-791) Control Fragment Recombinant Protein

Product Code. 30198978
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198978

Brand: Invitrogen™ RP94972

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57324 (PA5-57324. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP11A is a widely expressed integral membrane ATPase. ATP11A is probably phosphorylated in its intermediate state and likely drives the transport of ions such as calcium or other molecules across membranes. While the exact molecule ATP11A transports is unknown, increased expression of ATP11A mRNA has been observed in murine leukemia cells made resistant to anti-cancer drugs such as farnesyltransferase inhibitors (FTIs). Furthermore, overexpression of ATP11A provided protection against the FTI SCH66336 while knockdown of ATP11A via siRNA made cells more sensitive to this drug. Other reports suggest that elevated levels of ATP11A mRNA may also be a predictive marker of metastasis in colorectal cancer patients.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P98196
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23250
Name Human ATP11A (aa 697-791) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930558F19Rik; ATP11A; ATPase 11 A, class VI; ATPase 11 A, p type; ATPase class VI type 11 A; ATPase IS; ATPase phospholipid transporting 11 A; ATPase, class 1, member h; ATPase, class VI, type 11 A; Atpc1h; ATPIH; ATPIS; AU040868; Ih; KIAA1021; P4-ATPase flippase complex alpha subunit ATP11A; phospholipid-translocating ATPase; potential phospholipid-transporting ATPase IH; probable phospholipid-transporting ATPase IH; RP11-120K24.1; Ua20
Common Name ATP11A
Gene Symbol ATP11A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.