missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207329

Invitrogen™ Human ATP Synthase O (aa 149-213) Control Fragment Recombinant Protein

Product Code. 30207329
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207329

Brand: Invitrogen™ RP95885

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59548 (PA5-59548. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48047
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 539
Name Human ATP Synthase O (aa 149-213) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ATP synthase peripheral stalk subunit OSCP; ATP synthase subunit O, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (oligomycin sensitivity conferring protein); ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; DNA segment, Chr 12, Wayne State University 28, expressed; ATP5O; ATP5PO; ATPO; D12Wsu28e; HMC08D05; human ATP synthase OSCP subunit; oligomycin sensitivity conferral protein; oligomycin sensitivity conferral protein oscp-like protein; oligomycin sensitivity conferring protein; OSCP; Sperm flagella protein 4
Common Name ATP Synthase O
Gene Symbol ATP5PO
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.