Invitrogen™ Human ATP Synthase gamma (aa 138-212) Control Fragment Recombinant Protein

Product Code. 30201816

Brand: Invitrogen™ RP101426

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63914 (PA5-63914. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the gamma subunit of the catalytic core. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene also has a pseudogene on chromosome 14.

Specifications

• Accession Number: P36542
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 509
• Name: Human ATP Synthase gamma (aa 138-212) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700094F02Rik; ATP synthase F1 subunit gamma; ATP synthase gamma chain, mitochondrial; ATP synthase gamma-subunit gene encoding a mitochondrial protein; ATP synthase subunit gamma, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1; ATP5C; Atp5c1; ATP5CL1; ATP5F1C; F1 gamma; F-ATPase gamma subunit; mitochondrial ATP synthase, gamma subunit 1
• Common Name: ATP Synthase gamma
• Gene Symbol: ATP5F1C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining