Invitrogen™ Human ATP Synthase beta (aa 284-422) Control Fragment Recombinant Protein

Product Code. 30195177

Brand: Invitrogen™ RP100511

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81952 (PA5-81952. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP synthase is extremely conserved through evolution and can be found in plants, fungi, bacteria, and animals. The ATP synthase enzyme is a transmembrane protein responsible for driving the reversible reaction from ADP+ phosphate to ATP. This reaction is accomplished by a flux of protons across the membrane as a result of electron transfer. The ATP synthase protein has two main sections; the F1 ATP-ase (soluble) and the F0 ATP-ase (membrane embedded). The F1 section consists of the alpha, beta, gamma, delta, and epsilon subunits. While the F0 consists of a, b, and c subunits.

Specifications

• Accession Number: P06576
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 506
• Name: Human ATP Synthase beta (aa 284-422) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATP synthase F1 subunit beta; ATP synthase subunit beta, mitochondrial; ATP synthase, H+ transporting mitochondrial F1 complex, alpha subunit; ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide; Atp5b; ATP5F1B; ATPMB; ATPSB; beta-subunit; epididymis secretory protein Li 271; f1-ATPase beta; F1-ATPase beta-subunit; F-1-ATPase beta-subunit precursor; fj13e04; fj55c09; HEL-S-271; hm:zehn0534; hypothetical protein LOC554135; im:6793121; MGC5231; mitochondrial ATP synthase beta subunit; mitochondrial ATP synthase subunit beta subunit; mitochondrial ATP synthase, H+ transporting F1 complex beta subunit; mitochondrial ATP synthetase, beta subunit; wu:fj13e04; wu:fj38d01; wu:fj55c09; zgc:111961
• Common Name: ATP Synthase beta
• Gene Symbol: ATP5F1B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVAR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining