missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human ATP Synthase B1 (aa 197-256) Control Fragment Recombinant Protein

Produktkod. 30199229
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
Förpackningsstorlek
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30199229

missing translation for 'mfr': Invitrogen™ RP104194

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63434 (PA5-63434. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number P24539
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 515
Name Human ATP Synthase B1 (aa 197-256) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ATP synthase B chain, mitochondrial; ATP synthase F(0) complex subunit B1, mitochondrial; ATP synthase peripheral stalk-membrane subunit b; ATP synthase proton-transporting mitochondrial F(0) complex subunit B1; ATP synthase subunit b; ATP synthase subunit b, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1; Atp5f; ATP5F1; Atp5pb; ATPase subunit b; C76477; cell proliferation-inducing protein 47; H+-ATP synthase subunit b; PIG47
Common Name ATP Synthase B1
Gene Symbol ATP5PB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.