Invitrogen™ Human ATOH8 Control Fragment Recombinant Protein

Product Code. 30201763

missing translation for 'mfr': Invitrogen™ RP105790

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65024 (PA5-65024. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Basic helix-loop-helix (bHLH) transcription factors play important roles in differentiation processes during embryonic development of vertebrates. ATOH8 (MATH6) is a tissue-restricted member of the atonal superfamily of bHLH transcription factors that exhibits 43-57% identity in the bHLH domain with other mammalian atonal paralogs including the NeuroD and Neurogenin factors. In the mouse, ATOH8 has been implicated in the specification and differentiation of neuronal cell lineages in the brain and may also participate in kidney development. Recent studies show that ATOH8 is a novel component of the pancreatic transcriptional network during embryonic development and suggest a potential role as a modulator of the differentiation program initiated by the pro-endocrine factor Neurog3. It is indispensable for early embryonic development, suggesting a more widespread function for this factor in tissue-specific differentiation processes that are dependent on class II bHLH genes.

Specifications

• Accession Number: Q96SQ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84913
• Name: Human ATOH8 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933425C05Rik; Ath6; Atoh8; atonal bHLH transcription factor 8; atonal homolog 6; atonal homolog 8; atonal homolog 8 (Drosophila); atonal homolog bHLH transcription factor 8; basic helix loop helix transcription factor 6; basic helix-loop-helix transcription factor 6; bHLHa21; Class A basic helix-loop-helix protein 21; hATH6; Helix-loop-helix protein hATH-6; helix-loop-helix protein mATH-6; mATH6; Okadin; Protein atonal homolog 8; RGD1561512
• Common Name: ATOH8
• Gene Symbol: ATOH8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPYGAPHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining