missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATOH1 (aa 206-341) Control Fragment Recombinant Protein

Product Code. 30211929
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211929

Brand: Invitrogen™ RP110172

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144930 (PA5-144930. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Drosophila atonal gene produces a protein with basic helix loop helix (bHLH) domains that plays an essential role in the development of the Drosophila nervous system. Mammalian atonal homolog 1 (MATH-1) is a helix-loop-helix (HLH) transcription factor that is structurally homologous to the product of the Drosophila proneural gene atonal. MATH-1, so known as Atoh1, Ath1 or HATH-1, is a 351 amino acid protein with an atonal-related basic HLH domain. In mice, expression of MATH-1 takes place by embryonic day 9. 5 and initially localizes to the cranial ganglions and the dorsal part of the central nervous system. Prominent expression of MATH-1 is in the dorsal part of the central nervous system but becomes restricted to the external granular layer of the cerebellum by day 18 and is undetectable in the adult nervous system. It is suggested that MATH-1 may play a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92858
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 474
Name Human ATOH1 (aa 206-341) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ATH1; Atoh1; atonal bHLH transcription factor 1; atonal homolog 1; atonal homolog 1 (Drosophila); atonal homolog bHLH transcription factor 1; BHLHA14; Class A basic helix-loop-helix protein 14; H MATH-1; Hath1; Helix-loop-helix protein hATH-1; helix-loop-helix protein mATH-1; Math1; MATH-1; Protein atonal homolog 1; RGD1565171
Common Name ATOH1
Gene Symbol Atoh1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.