Invitrogen™ Human ATL2 (aa 22-82) Control Fragment Recombinant Protein

Product Code. 30194480

Brand: Invitrogen™ RP108654

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111729 (PA5-111729. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATL2 gene ontology annotations related to this gene include GTPase activity; GTP binding.

Specifications

• Accession Number: Q8NHH9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64225
• Name: Human ATL2 (aa 22-82) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010110I21Rik; AA407293; ADAMTSL-2; ADP-ribosylation factor-like 6 interacting protein 2; ADP-ribosylation factor-like protein 6-interacting protein 2; ADP-ribosylation-like factor 6 interacting protein 2; aip-2; ARL3IP2; ARL-6 interacting protein-2; ARL-6-interacting protein 2; ARL6IP2; Atl2; atlastin GTPase 2; atlastin GTPase 2; atlastin-2; atlastin2; atlastin-2; AV334690; fc06e01; GPHYSD1; wu:fc06e01; wu:fc06e01 protein; wu:fv60d03
• Common Name: ATL2
• Gene Symbol: ATL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining