Invitrogen™ Human ATG9A (aa 151-207) Control Fragment Recombinant Protein

Product Code. 30197583

Brand: Invitrogen™ RP101608

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Macroautophagy is the major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane bound autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane bound structure, which then fuse with the lysosome (or vacuole) releasing a single-membrane bound autophagic bodies which are then degraded within the lysosome (or vacuole). Apg9 plays a direct role in the formation of the cytoplasm to vacuole targeting and autophagic vesicles, possibly serving as a marker for a specialized compartment essential for these vesicle-mediated alternative targeting pathways.

Specifications

• Accession Number: Q7Z3C6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79065
• Name: Human ATG9A (aa 151-207) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Apg9; APG9 autophagy 9-like 1; Apg911; APG9A; APG9L1; APG9-like 1; ATG 9 A; Atg9; ATG9 autophagy related 9 homolog A; ATG9 autophagy related 9 homolog A (S. cerevisiae); Atg9a; Atg9l1; AU019532; autophagy 9-like 1 protein; autophagy protein 9; autophagy related 9 A; autophagy-related 9 A; autophagy-related 9-like 1; autophagy-related protein 9; autophagy-related protein 9 A; FLJ22169; mATG9; MGD3208; RGD1310450; zgc:158700
• Common Name: ATG9A
• Gene Symbol: ATG9A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining