missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATG9A (aa 151-207) Control Fragment Recombinant Protein

Product Code. 30197583
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197583

Brand: Invitrogen™ RP101608

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Macroautophagy is the major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane bound autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane bound structure, which then fuse with the lysosome (or vacuole) releasing a single-membrane bound autophagic bodies which are then degraded within the lysosome (or vacuole). Apg9 plays a direct role in the formation of the cytoplasm to vacuole targeting and autophagic vesicles, possibly serving as a marker for a specialized compartment essential for these vesicle-mediated alternative targeting pathways.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z3C6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79065
Name Human ATG9A (aa 151-207) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Apg9; APG9 autophagy 9-like 1; Apg911; APG9A; APG9L1; APG9-like 1; ATG 9 A; Atg9; ATG9 autophagy related 9 homolog A; ATG9 autophagy related 9 homolog A (S. cerevisiae); Atg9a; Atg9l1; AU019532; autophagy 9-like 1 protein; autophagy protein 9; autophagy related 9 A; autophagy-related 9 A; autophagy-related 9-like 1; autophagy-related protein 9; autophagy-related protein 9 A; FLJ22169; mATG9; MGD3208; RGD1310450; zgc:158700
Common Name ATG9A
Gene Symbol ATG9A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.