Invitrogen™ Human ATG5 (aa 126-265) Control Fragment Recombinant Protein

Product Code. 30210980

Brand: Invitrogen™ RP89637

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATG5 (Autophagy Related 5) is an important element for autophagy and may play an important role in the apoptotic process. ATG5 is also involved in other cellular processes that include mitochondrial quality control after oxidative damage, negative regulation of the innate anti-viral immune response, lymphocyte development and proliferation, MHC II antigen presentation, and adipocyte differentiation. Following conjugation to ATG12, the conjugate participates in the formation of autophagosome. ATG5 contributes to autophagic cell death by interacting with Fas-associated protein with death domain (FADD). The ATG5-ATG12 conjugate forms a cup-shaped isolation membrane that then detaches from the membrane immediately before or after autophagosome formation is completed. APG5 may play a role in the apoptotic process, possibly within the modified cytoskeleton. Further, APG5 expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. The APG5-APG12 conjugate also associates with innate immune response proteins such as RIG-I and VISA (also known as IPS-1), inhibiting type I interferon production and permitting viral replication in host cells. Diseases associated with ATG5 dysfunction include spinocerebellar ataxia.

Specifications

• Accession Number: Q9H1Y0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9474
• Name: Human ATG5 (aa 126-265) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010107M05Rik; 3110067M24Rik; APG 5; APG5; APG5 autophagy 5 like (APG5L); APG5 autophagy 5-like protein; APG5 autophagy 5-like protein, isoform 1; APG5L; APG5-LIKE; apoptosis-specific protein; Apoptosis-specific protein (ASP); ASP; atg5; Atg-5; ATG5 autophagy related 5 homolog; ATG5 autophagy related 5 homolog (S. cerevisiae); atg5.L; Atg5l; Atg5-PA; autophagy 5-like protein; autophagy protein 5; autophagy related 5; autophagy related 5 L homeolog; autophagy related 5-like protein; Autophagy-related 5; autophagy-specific gene 5; AW319544; C88337; CG1643; CG1643-PA; DmAtg5; Dmel\CG1643; Dmel_CG1643; hAPG5; hypothetical protein LOC532686; LD34980p; Paddy; XELAEV_18027227mg; zgc:100934
• Common Name: ATG5
• Gene Symbol: Atg5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining