Invitrogen™ Human ATG4C (aa 246-353) Control Fragment Recombinant Protein

Product Code. 30204334

missing translation for 'mfr': Invitrogen™ RP89641

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110718 (PA5-110718. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATG4C is involved in autophagy, the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. Highly expressed in skeletal muscle, heart, liver and testis.

Specifications

• Accession Number: Q96DT6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84938
• Name: Human ATG4C (aa 246-353) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: APG4 (ATG4) autophagy-related homolog C; APG4 autophagy 4 homolog C; APG4C; APG4-C; ATG4 autophagy related 4 homolog C; ATG4C; Atg4cl; AUTL1; AUTL3; AUT-like 1, cysteine endopeptidase; AUT-like 3 cysteine endopeptidase; autophagin 3; autophagin-3; autophagy related 4 C cysteine peptidase; autophagy related 4 C, cysteine peptidase; autophagy-related 4 C; autophagy-related cysteine endopeptidase 3; Autophagy-related protein 4 homolog C; cysteine peptidase; cysteine protease ATG4C; cysteine protease involved in autophagy; FLJ14867
• Common Name: ATG4C
• Gene Symbol: ATG4C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining