Invitrogen™ Human ATG16L2 (aa 262-348) Control Fragment Recombinant Protein

Artikelnummer. 30197673

missing translation for 'mfr': Invitrogen™ RP97441

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61000 (PA5-61000. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in autophagy. [UniProt]

Spezifikation

• Accession Number: Q8NAA4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 89849
• Name: Human ATG16L2 (aa 262-348) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410118P20Rik; APG16-like 2; ATG16 autophagy related 16-like 2; ATG16B; Atg16l2; Atg16L2 alpha; Atg16L2 beta; autophagy related 16 like 2; autophagy related 16-like 2; autophagy related 16-like 2 (S. cerevisiae); autophagy-related 16-like 2 alpha; autophagy-related 16-like 2 beta; autophagy-related protein 16-2; mFLJ00012 protein; RGD1311400; WD repeat-containing protein 80; WDR80
• Common Name: ATG16L2
• Gene Symbol: ATG16L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining