missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATG16L1 (aa 88-168) Control Fragment Recombinant Protein

Product Code. 30209904
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209904

Brand: Invitrogen™ RP104062

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Autophagy related protein 16 L is encoded by the ATG16L gene and is located on chromosome 2 in humans. It is also known as WD30 or IBD10 (Inflammatory Bowel Disease 10). ATG 12 and ATG5 conjugate with each other and undergoes homo oligomerisation with ATG16L to form an 800 kDa complex called the Atg16L complex. This complex facilitates coupling or lipidation of LC3 to phosphatidylethanolamine (PE) and this ubiquitin-like conjugation system is a widely used marker for autophagy. However, the ATG 16L complex along with other ATGs like ATG 18 and ATG 21 prevent the premature cleavage of ATG8-PE by the cysteine protease, Atg4 until the autophagosome is deemed complete.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q676U5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55054
Name Human ATG16L1 (aa 88-168) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500009K01Rik; A16L1; APG 16-L1; Apg16l; APG16L beta; APG16L isoforms 1; APG16-like 1; atg16; ATG16 autophagy related 16-like 1; ATG16A; Atg16l; Atg16l1; Atg16L1 gamma; autophagy related 16 like 1; autophagy related 16-like 1; autophagy related 16-like 1 (S. cerevisiae); autophagy-related 16-like 1; autophagy-related 16-like 1 gamma; autophagy-related protein 16-1; hCG_1817841; IBD10; UNQ9393/PRO34307; WD repeat domain 30; Wdr30
Common Name ATG16L1
Gene Symbol ATG16L1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.