Invitrogen™ Human ATF1 (aa 1-64) Control Fragment Recombinant Protein

Product Code. 30195335

Brand: Invitrogen™ RP103207

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84236 (PA5-84236. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an activating transcription factor, which belongs to the ATF subfamily and bZIP (basic-region leucine zipper) family. It influences cellular physiologic processes by regulating the expression of downstream target genes, which are related to growth, survival, and other cellular activities. This protein is phosphorylated at serine 63 in its kinase-inducible domain by serine/threonine kinases, cAMP-dependent protein kinase A, calmodulin-dependent protein kinase I/II, mitogen- and stress-activated protein kinase and cyclin-dependent kinase 3 (cdk-3). Its phosphorylation enhances its transactivation and transcriptional activities, and enhances cell transformation. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in angiomatoid fibrous histiocytoma and clear cell sarcoma. This gene has a pseudogene on chromosome 6.

Specifications

• Accession Number: P18846
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 466
• Name: Human ATF1 (aa 1-64) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AATase 1; Activating transcription factor 1; alcohol O-acetyltransferase; Alcohol O-acetyltransferase 1; ATF1; Atf-1; cAMP-dependent transcription factor ATF-1; cyclic AMP-dependent transcription factor ATF-1; EWS-ATF1; FUS/ATF-1; Protein TREB36; TCR-ATF1; TREB36; Unknown (protein for MGC:64099); wu:fc92c07; YOR377W; zgc:64099
• Common Name: ATF1
• Gene Symbol: ATF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining