Invitrogen™ Human ATCAY (aa 273-369) Control Fragment Recombinant Protein

Product Code. 30212992

Brand: Invitrogen™ RP91026

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53636 (PA5-53636. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type.

Specifications

• Accession Number: Q86WG3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85300
• Name: Human ATCAY (aa 273-369) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3322401A10Rik; ataxia cayman type protein; ataxia cerebellar Cayman type; ataxia, cerebellar, Cayman type; ataxia, cerebellar, Cayman type homolog (human); Atcay; ATCAY, caytaxin; BB077577; BNIP-2-homolgy; BNIP-2-homology; BNIP-H; Cayman ataxia; caytaxin; CLAC; hes; hesitant; ji; jittery; KIAA1872
• Common Name: ATCAY
• Gene Symbol: ATCAY
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSWFIRTVLAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining