Invitrogen™ Human ATAD2 (aa 1084-1197) Control Fragment Recombinant Protein

Product Code. 30194874

Brand: Invitrogen™ RP92425

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATAD2 is a member of the ATPase family of proteins. Members of this family share a conserved region of around 220 amino acids that contain an ATP-binding site. They also contain one or two AAA (ATPases Associated with Diverse Cellular Activities) domains. ATPase family proteins perform chaperone-like functions that assist in assembly, operation, and disassembly of protein complexes. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells.

Specifications

• Accession Number: Q6PL18
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29028
• Name: Human ATAD2 (aa 1084-1197) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610509G12Rik; AAA nuclear coregulator cancer-associated protein; ANCCA; Atad2; ATPase family AAA domain-containing protein 2; ATPase family, AAA domain containing 2; CT137; L16; PRO2000
• Common Name: ATAD2
• Gene Symbol: ATAD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining