Invitrogen™ Human Astrotactin (aa 696-793) Control Fragment Recombinant Protein

Product Code. 30193984

Brand: Invitrogen™ RP107974

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67327 (PA5-67327. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Astrotactin is a neuronal adhesion molecule required for glial-guided migration of young postmitotic neuroblasts in cortical regions of developing brain, including cerebrum, hippocampus, cerebellum, and olfactory bulb (Fink et al., 1995).

Specifications

• Accession Number: O14525
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 460
• Name: Human Astrotactin (aa 696-793) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Astn; Astn1; astrotactin 1; astrotactin-1; GC14; KIAA0289; mKIAA0289; neuronal migration protein GC14; synaptogenesis-related mRNA sequence 1
• Common Name: Astrotactin
• Gene Symbol: Astn1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDYKLGVDGRSCQLITETCPEGSDCGESRELPMNQTLFGEMFFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQLPDGLVVATVPLENQCLEEISEPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining