Invitrogen™ Human ASTN2 (aa 766-904) Control Fragment Recombinant Protein

Product Code. 30200333

Brand: Invitrogen™ RP90988

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55491 (PA5-55491. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is expressed in the brain and may function in neuronal migration, based on functional studies of the related astrotactin 1 gene in human and mouse. A deletion at this locus has been associated with schizophrenia. Multiple transcript variants encoding different proteins have been found for this locus.

Specifications

• Accession Number: O75129
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23245
• Name: Human ASTN2 (aa 766-904) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1d8; Astn2; Astnl; astrotactin 2; astrotactin 2-like; astrotactin-2; bA264C15.1; bA67K19.1; bM243L4.1 (astrotactin 2); bM264P11.1 (astrotactin 2); bM383P24.1 (astrotactin 2); bM423P8.1 (astrotactin 2); bM452J22.1; bM452J22.1 (novel protein); bM468K2.1 (astrotactin 2); Kiaa0634
• Common Name: ASTN2
• Gene Symbol: ASTN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSKFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSREELLSFIQHYGSHY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining